PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00060.1.g00710.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 509aa    MW: 55274 Da    PI: 6.6832
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00060.1.g00710.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.91.5e-17214267356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Zpz_sc00060.1.g00710.1.am.mk 214 KKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWK 267
                                   4568999**********************************************9 PP

2HD-ZIP_I/II123.78.5e-40213302190
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrl+ eqv++LE++Fe  +kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da+k++n++L 
  Zpz_sc00060.1.g00710.1.am.mk 213 EKKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKADNDALV 293
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLree 90 
                                   +++++L++e
  Zpz_sc00060.1.g00710.1.am.mk 294 SHNKKLQAE 302
                                   ******976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-18195270IPR009057Homeodomain-like
SuperFamilySSF466894.71E-19207271IPR009057Homeodomain-like
PROSITE profilePS5007117.346209269IPR001356Homeobox domain
SMARTSM003891.3E-17212273IPR001356Homeobox domain
PfamPF000466.0E-15214267IPR001356Homeobox domain
CDDcd000864.72E-17214270No hitNo description
PRINTSPR000313.3E-5240249IPR000047Helix-turn-helix motif
PROSITE patternPS000270244267IPR017970Homeobox, conserved site
PRINTSPR000313.3E-5249265IPR000047Helix-turn-helix motif
PfamPF021833.2E-11269303IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MAERIISCAS AAAQVEGALL LHHGMAEGAT CGTDRSSYVV SSGHVHVPHA NARGPPDSSG  60
EGAEPCTLHV SLCVGLSLLA ATPIRPMHPA PDDAVGYSFL MPMASNGMAS SPPSFFPPNF  120
LLQMQQTPLD HDPQEHHHSH LHPPPLHHPH HNPFLPSSQC PSLQDFQGRA PMLGKRPMYG  180
ADVGAGDDLN GCGGGGDEAS KDELSDDGSQ AGEKKRRLNV EQVRTLEKNF ELGNKLEPER  240
KLQLARALGL QPRQVAIWFQ NRRARWKTKQ LEKDYDALKR QLDAVKADND ALVSHNKKLQ  300
AERSQQKGCW KRRRWELAFH LRADVVLTAF VESCCSKAGA ASEWPATAPP GLCSFLPLSH  360
DATLTQSIYS SWLLRIVLAL KGGREAGSEL INLNKETEAS CSNRSENSSE INLDISRTPP  420
SEGPVDPPAH QHQHAGNGAG GMIPFYPSVG RSAGLDFDQL LHSSSGPKME QHGSGDGVQA  480
PEQTSFGNLL CCVDEPPPFW PWADHQHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261269RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1693751e-154AC169375.4 Sorghum bicolor clone SB_BBc0020O07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotA2XD082e-78HOX21_ORYSI; Homeobox-leucine zipper protein HOX21
TrEMBLA3AEK51e-129A3AEK5_ORYSJ; Uncharacterized protein
STRINGBGIOSGA011366-PA1e-127(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-56HD-ZIP family protein